General Information

  • ID:  hor001825
  • Uniprot ID:  F1LHJ0
  • Protein name:  Neuropeptide AF23
  • Gene name:  NA
  • Organism:  Ascaris suum (Pig roundworm) (Ascaris lumbricoides)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ascaris (genus), Ascarididae (family), Ascaridoidea (superfamily), Ascaridomorpha (infraorder), Spirurina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SGMRNALVRF
  • Length:  10
  • Propeptide:  MVSSPTPLYSRSFSFAQMLRSTVVGLFACIAVAVVASAEDDEQVAEKRAMRNALVRFGRSGMRNALVRFGKRADDNEYSTLDEKRNGAPQPFVRFGRSGRVDHIHDILSTLQRLQLANE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have potent bioactivity in the locomotory and feeding systems
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F1LHJ0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001825_AF2.pdbhor001825_ESM.pdb

Physical Information

Mass: 131107 Formula: C49H83N17O13S
Absent amino acids: CDEHIKPQTWY Common amino acids: R
pI: 12.5 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 8 Boman Index: -2284
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 1380 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17436302
  • Title:  Peptide Products of the afp-6 Gene of the Nematode Ascaris Suum Have Different Biological Actions